PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN13255.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 345aa    MW: 38017.4 Da    PI: 6.5779
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN13255.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +++ +v+ +G+g+W++++++ g++R++k+c++rw +yl
       KHN13255.1 14 RGLWTPEEDAKILAYVANHGTGNWTLVPKKAGLNRCGKSCRLRWTNYL 61
                     788*******************************************97 PP

2Myb_DNA-binding44.73e-1470110446
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +T++E++l+++++   G++ W++Ia++++ gRt++++k++w++
       KHN13255.1  70 FTPQEEDLIINLHGAIGSR-WSLIAKRLP-GRTDNDVKNYWNT 110
                      9******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-25564IPR009057Homeodomain-like
PROSITE profilePS5129427.371965IPR017930Myb domain
SuperFamilySSF466891.5E-3011108IPR009057Homeodomain-like
SMARTSM007175.5E-151363IPR001005SANT/Myb domain
PfamPF002492.7E-171461IPR001005SANT/Myb domain
CDDcd001676.84E-121761No hitNo description
Gene3DG3DSA:1.10.10.602.0E-2365116IPR009057Homeodomain-like
SMARTSM007174.3E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129416.95366116IPR017930Myb domain
PfamPF002494.2E-1370110IPR001005SANT/Myb domain
CDDcd001671.53E-1070112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MRRPPCCDKS NVKRGLWTPE EDAKILAYVA NHGTGNWTLV PKKAGLNRCG KSCRLRWTNY  60
LRPDLKHDGF TPQEEDLIIN LHGAIGSRWS LIAKRLPGRT DNDVKNYWNT KLRKKLMKMG  120
IDPVTHKPVS QVLSDLGSIS GLPNTTNQMA FVNKDLMMSN MPPTKTEPSD SNKSMVEHTQ  180
EGQVHSWEHH IPYQVIINSE NVQPQVLSEA ASSTSSSSSS NLTQLGSPQS YSCQTPQAQI  240
SPPCSSFDWS EFLHSDSFNW SLNPPSGLMQ SEAELSDNTK SNGHDMQGAA SEGSGSGSGA  300
VACGASMEYQ INKQCEAHSF VDGILDRDSE IRAAFPQLLD ASFDY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150441e-177AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003543842.20.0PREDICTED: transcription factor MYB35-like
TrEMBLA0A0B2PVW10.0A0A0B2PVW1_GLYSO; Transcription factor MYB86
STRINGGLYMA13G04920.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.12e-84MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]